PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G033504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 203aa    MW: 22190.9 Da    PI: 6.7072
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G033504.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.46.2e-35151141100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca Ck++r+kC+++C +apyfpa++ +++ n++k+FG++n++++++++++++r +a+++l+ eA ar +dPv+G++g+i++l+ q++ 
  HL.SW.v1.0.G033504.1  15 PCACCKHQRKKCSPNCQMAPYFPATKYQEYLNAQKIFGTTNIVRIVNSVEPHNRVAAADTLMAEALARRNDPVRGCYGIIRHLKLQVAL 103
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           ++a+l +++++
  HL.SW.v1.0.G033504.1 104 HEAQLLHVNRQ 114
                           ****9988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.68814115IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3215111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MASSGSDEDG EGFLPCACCK HQRKKCSPNC QMAPYFPATK YQEYLNAQKI FGTTNIVRIV  60
NSVEPHNRVA AADTLMAEAL ARRNDPVRGC YGIIRHLKLQ VALHEAQLLH VNRQLAFFKA  120
QEEKHVQKQM DLEKLQLFAS LSSPANDGAG TSAAMNNIAR PSHSNTGSSS TANPADLTPT  180
STHKQIIDLE SLDFEDESAD LY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460121.17e-42PREDICTED: LOB domain-containing protein 9-like
TrEMBLA0A067E2B94e-39A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
TrEMBLV4UQJ26e-39V4UQJ2_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-31LOB domain-containing protein 22